(data stored in ACNUC7421 zone)

EMBL: CP000820.PE149

CP000820.PE149       Location/Qualifiers
FT   CDS             complement(178948..179829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0151"
FT                   /product="protein of unknown function DUF191"
FT                   /note="PFAM: protein of unknown function DUF191; KEGG:
FT                   fal:FRAAL6735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09618"
FT                   /db_xref="GOA:A8LCH9"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH9"
FT                   /protein_id="ABW09618.1"
FT                   /translation="MSTPPIGSEGGAPAPDQLTLAISPCPNDTFAFHALIHGLVPGAPA
FT                   VSTTFADIDVLNARAADGRDDLVKVSYAALPWLLDRYSLLTAGGALGRGCGPLVLTAGR
FT                   TDLRDASVAIPGTRTTAYLLFRLWAEQLGIGSINVVPFDRIMPAVRDGQYDAGLVIHES
FT                   RFTYPSYGLTAVADLGDWWEGRTGLPIPLGAIVARRGLDTAALSAAVRASVAAAFADRA
FT                   ASATFVIEHAQEMAPEVANAHIELYVNDFTLDLGDEGLAAVQELLGRAAAAGLVPELPA
FT                   GALTATALATGA"
     MSTPPIGSEG GAPAPDQLTL AISPCPNDTF AFHALIHGLV PGAPAVSTTF ADIDVLNARA        60
     ADGRDDLVKV SYAALPWLLD RYSLLTAGGA LGRGCGPLVL TAGRTDLRDA SVAIPGTRTT       120
     AYLLFRLWAE QLGIGSINVV PFDRIMPAVR DGQYDAGLVI HESRFTYPSY GLTAVADLGD       180
     WWEGRTGLPI PLGAIVARRG LDTAALSAAV RASVAAAFAD RAASATFVIE HAQEMAPEVA       240
     NAHIELYVND FTLDLGDEGL AAVQELLGRA AAAGLVPELP AGALTATALA TGA              293
//

If you have problems or comments...

PBIL Back to PBIL home page