(data stored in ACNUC7421 zone)

EMBL: CP000820.PE15

CP000820.PE15        Location/Qualifiers
FT   CDS             complement(20881..21498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0015"
FT                   /product="Endopeptidase Clp"
FT                   /EC_number="3.4.21.92"
FT                   /note="PFAM: peptidase S14 ClpP; KEGG: fal:FRAAL4270
FT                   proteolytic subunit of ClpA-ClpP ATP-dependent serine
FT                   protease (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09484"
FT                   /db_xref="GOA:A8LB30"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB30"
FT                   /protein_id="ABW09484.1"
FT                   /translation="MPGYLLPVDVAAVRRPTGRGLAGGGLVEGLKAGFVGAAVDDALAN
FT                   RVCAQLLLLAQASRRQDISLYINSPGGSVDAGMAIYDTMQFIENDVATYALGLAASMGQ
FT                   FLLTAGTAGKRFALPNSRIMMHQPHGGVGGTASDIAIQAEQALHTRRRMQELIAEHSGH
FT                   SVAEIAADSDRDRWFTAAAAKEYGLVDAVVEHVRRVPAGFTR"
     MPGYLLPVDV AAVRRPTGRG LAGGGLVEGL KAGFVGAAVD DALANRVCAQ LLLLAQASRR        60
     QDISLYINSP GGSVDAGMAI YDTMQFIEND VATYALGLAA SMGQFLLTAG TAGKRFALPN       120
     SRIMMHQPHG GVGGTASDIA IQAEQALHTR RRMQELIAEH SGHSVAEIAA DSDRDRWFTA       180
     AAAKEYGLVD AVVEHVRRVP AGFTR                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page