(data stored in ACNUC7421 zone)

EMBL: CP000820.PE150

CP000820.PE150       Location/Qualifiers
FT   CDS             complement(179868..180809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6734 conserved hypothetical protein;
FT                   putative purine and uridine phosphorylase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09619"
FT                   /db_xref="GOA:A8LCI0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR019963"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCI0"
FT                   /protein_id="ABW09619.1"
FT                   /translation="MTRTLIVTAVNAEADAVCAGLMGSWSRGRSRTPSGPGGLVSPDWD
FT                   RQLLTTSTLGPYVGRRRGPVTVLAAGPAGPASAAGTAVALAVASAAGEPFGLVISMGIA
FT                   GGFRGWAEVGDLVIADRMVAADLGAESGLDEPAEPAAPVRINEMDRNLGFHPAGAPPYQ
FT                   PGPPPGPVAAGAFLTMDDLGLGSSTLQPDADLVRRLTTVLDITGRRIVSGTVLTVSTVT
FT                   GTERRAAALTARLDPVAEAMEGYAVGIAAGAFGVPVTEIRAVSNPVGRRDRAAWNTQAA
FT                   LGSLRTAAAALVAHPEGLVPAPRAEKESGPTG"
     MTRTLIVTAV NAEADAVCAG LMGSWSRGRS RTPSGPGGLV SPDWDRQLLT TSTLGPYVGR        60
     RRGPVTVLAA GPAGPASAAG TAVALAVASA AGEPFGLVIS MGIAGGFRGW AEVGDLVIAD       120
     RMVAADLGAE SGLDEPAEPA APVRINEMDR NLGFHPAGAP PYQPGPPPGP VAAGAFLTMD       180
     DLGLGSSTLQ PDADLVRRLT TVLDITGRRI VSGTVLTVST VTGTERRAAA LTARLDPVAE       240
     AMEGYAVGIA AGAFGVPVTE IRAVSNPVGR RDRAAWNTQA ALGSLRTAAA ALVAHPEGLV       300
     PAPRAEKESG PTG                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page