(data stored in ACNUC7421 zone)

EMBL: CP000820.PE151

CP000820.PE151       Location/Qualifiers
FT   CDS             complement(181053..182849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0153"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   fal:FRAAL6732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09620"
FT                   /db_xref="GOA:A8LCI1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCI1"
FT                   /protein_id="ABW09620.1"
FT                   /translation="MKPGSTLTEGLSRLRATIRRDGAQQSGLSSLTELSFVNAAGDALV
FT                   TVALAGSLFFAVPTGEARSKVALYLLITMVPFALLAPVVGPLLDRVAYGRRTALAAICL
FT                   GRCLLAWQLAGALDGLAVYPLALGLLVLSRAFGVARSAVVPRVTPPEMTLVKVNSRISL
FT                   VNIVAGAVVAPLGLGLANIPFVGYPWVLRVCALIYMAGVLLAFNLPGHVDSAAGERTLR
FT                   ELTGPRRRGNLRTRFAAALGALPVALRATLVLRGLVGFLTFYLAFLLRTNGGNNLWLGA
FT                   LAATAGFGSGIGVLIGGRLGRRRPEGILMLGLLLAASGCLVAAVTYTRFTSLVAALLAM
FT                   TAGSMAKLALDAIIQRDIVEDTRGSAFARSETALQLGWVTGGAFGLIEMPGTLGFALAA
FT                   AAVGLALVLQSRALREARRQARERHRPTARETTGAKPPWPGPQAPAQPSAPVADTVPAP
FT                   AGYATTGYATTDRAVADPTATDPTAVGPPPVSPAGAGAVPTGSMNGWYAPDPRADVPVS
FT                   WRGPAGGGQRAGGDPDATNPLGHPPVPGPAAAEGPGGAYGPAPQLHHAYQQPTPAVPRT
FT                   LEDPDPPNGSARRGRWRRDRPR"
     MKPGSTLTEG LSRLRATIRR DGAQQSGLSS LTELSFVNAA GDALVTVALA GSLFFAVPTG        60
     EARSKVALYL LITMVPFALL APVVGPLLDR VAYGRRTALA AICLGRCLLA WQLAGALDGL       120
     AVYPLALGLL VLSRAFGVAR SAVVPRVTPP EMTLVKVNSR ISLVNIVAGA VVAPLGLGLA       180
     NIPFVGYPWV LRVCALIYMA GVLLAFNLPG HVDSAAGERT LRELTGPRRR GNLRTRFAAA       240
     LGALPVALRA TLVLRGLVGF LTFYLAFLLR TNGGNNLWLG ALAATAGFGS GIGVLIGGRL       300
     GRRRPEGILM LGLLLAASGC LVAAVTYTRF TSLVAALLAM TAGSMAKLAL DAIIQRDIVE       360
     DTRGSAFARS ETALQLGWVT GGAFGLIEMP GTLGFALAAA AVGLALVLQS RALREARRQA       420
     RERHRPTARE TTGAKPPWPG PQAPAQPSAP VADTVPAPAG YATTGYATTD RAVADPTATD       480
     PTAVGPPPVS PAGAGAVPTG SMNGWYAPDP RADVPVSWRG PAGGGQRAGG DPDATNPLGH       540
     PPVPGPAAAE GPGGAYGPAP QLHHAYQQPT PAVPRTLEDP DPPNGSARRG RWRRDRPR         598
//

If you have problems or comments...

PBIL Back to PBIL home page