(data stored in ACNUC7421 zone)

EMBL: CP000820.PE153

CP000820.PE153       Location/Qualifiers
FT   CDS             complement(184343..186652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0155"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: fal:FRAAL6730
FT                   phosphoribosylformylglycinamidine synthase II (FGAM
FT                   synthase II); TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase II; PFAM: AIR synthase related protein; AIR
FT                   synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09622"
FT                   /db_xref="GOA:A8LCI3"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LCI3"
FT                   /protein_id="ABW09622.1"
FT                   /translation="MTGTPSAPTTSPDDQADGPGEGTVDRQPYRELGLTDDEYERIVAT
FT                   LGRVPTDAELAMYSVMWSEHCSYKSSKVHLRQFRDTPATDRLLVGMGENAGVVDVGEGL
FT                   AVTFKVESHNHPSFVEPYQGAATGVGGIVRDILTMGARPIGILDPLRFGAADAPDTARV
FT                   LPGVVAGIGGYGNCLGLPTIGGEVVFDPVYGGNPLVNALCVGVMPVGRVQTSAATGVGN
FT                   AVVLLGAKTGRDGIGGVSVLASATFDEGGGPARRPSVQVGDPFTEKILIECCLELFDRG
FT                   LVTGIQDLGGAGLTCALTETTAAGIATGQPGGMEVDLDLVPLREASMAAHEVLASESQE
FT                   RMLAIVTPDALPEVLALAERWGVIATNIGTVTDSGRLVVRWHGEVVVDVPPGSLADDGP
FT                   VYERPLRRPADLDLLRADAPSALERPRTGDALRATLLRMIASPNLCSRAWVTEQYDRYV
FT                   QANTVLAQPEDAGVLRLSASGLGIALATDGNGRYARLDPFAGAQLALAEACRNVTAAGA
FT                   EPIAVTNCLNFGSPEDPEVMWQFAQACAGLADACRRLGLPVTGGNVSFYNQTGSAPIHP
FT                   TPVVGVLGLFDDVTRRTPIGFTDEGDALLLLGDTRDEFGGSEWAWATHGHLGGTPPAVD
FT                   LEREKLLGEILVGGSREGLLTAAHDLSEGGLAQALVESCLRGGHGARIELPAGADAFVE
FT                   LFSESAGRAVVAVPAAEQDRFARLCADRGLPCRQIGVVTDGEGGSLNVAGEFAIPLDEL
FT                   RAAHEGTLPRLFGRGA"
     MTGTPSAPTT SPDDQADGPG EGTVDRQPYR ELGLTDDEYE RIVATLGRVP TDAELAMYSV        60
     MWSEHCSYKS SKVHLRQFRD TPATDRLLVG MGENAGVVDV GEGLAVTFKV ESHNHPSFVE       120
     PYQGAATGVG GIVRDILTMG ARPIGILDPL RFGAADAPDT ARVLPGVVAG IGGYGNCLGL       180
     PTIGGEVVFD PVYGGNPLVN ALCVGVMPVG RVQTSAATGV GNAVVLLGAK TGRDGIGGVS       240
     VLASATFDEG GGPARRPSVQ VGDPFTEKIL IECCLELFDR GLVTGIQDLG GAGLTCALTE       300
     TTAAGIATGQ PGGMEVDLDL VPLREASMAA HEVLASESQE RMLAIVTPDA LPEVLALAER       360
     WGVIATNIGT VTDSGRLVVR WHGEVVVDVP PGSLADDGPV YERPLRRPAD LDLLRADAPS       420
     ALERPRTGDA LRATLLRMIA SPNLCSRAWV TEQYDRYVQA NTVLAQPEDA GVLRLSASGL       480
     GIALATDGNG RYARLDPFAG AQLALAEACR NVTAAGAEPI AVTNCLNFGS PEDPEVMWQF       540
     AQACAGLADA CRRLGLPVTG GNVSFYNQTG SAPIHPTPVV GVLGLFDDVT RRTPIGFTDE       600
     GDALLLLGDT RDEFGGSEWA WATHGHLGGT PPAVDLEREK LLGEILVGGS REGLLTAAHD       660
     LSEGGLAQAL VESCLRGGHG ARIELPAGAD AFVELFSESA GRAVVAVPAA EQDRFARLCA       720
     DRGLPCRQIG VVTDGEGGSL NVAGEFAIPL DELRAAHEGT LPRLFGRGA                   769
//

If you have problems or comments...

PBIL Back to PBIL home page