(data stored in ACNUC7421 zone)

EMBL: CP000820.PE155

CP000820.PE155       Location/Qualifiers
FT   CDS             complement(187820..188188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0157"
FT                   /product="ABC-type proline/glycine betaine transport
FT                   systems permease component-like protein"
FT                   /note="KEGG: fal:FRAAL6728 putative ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09624"
FT                   /db_xref="GOA:A8LCI5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCI5"
FT                   /protein_id="ABW09624.1"
FT                   /translation="MDGVSTPTGVSGWQILRDVELPLAAPMIIIGLRLAAVQVVGTATI
FT                   ATLIGGGGLGRFVVDGLAHADVRQVAVGRGSPSCGRPGDNGRSGLHWQLVARQGDPGRG
FT                   RAARQRQRRQDEGWGRRT"
     MDGVSTPTGV SGWQILRDVE LPLAAPMIII GLRLAAVQVV GTATIATLIG GGGLGRFVVD        60
     GLAHADVRQV AVGRGSPSCG RPGDNGRSGL HWQLVARQGD PGRGRAARQR QRRQDEGWGR       120
     RT                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page