(data stored in ACNUC7421 zone)

EMBL: CP000820.PE158

CP000820.PE158       Location/Qualifiers
FT   CDS             complement(189925..190884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6721 hypothetical protein; putative
FT                   nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09627"
FT                   /db_xref="GOA:A8LCI8"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCI8"
FT                   /protein_id="ABW09627.1"
FT                   /translation="MAKVIVAGGGIAGVACARELRARGISVEVRDRGRVIGGRMASRWI
FT                   DGRIVDAGASYFTARSPEFLEVVDDWLIRGLVRPWTHRFPVIDGPSATLSEPVPGPLRY
FT                   AAPHGIRSLVADLATRGGLRVSQSSPIGMVRPGPVVDGEPVDAVVLAMPDPQALRHLDP
FT                   DLDTERTELIGRRWSPALALLAGWEARGWPPLDGAFVHGDPTVVWIADDGRRRGDNAPV
FT                   LVAHSTAEFAAGRLTDPRAAAGDLTAALRRLLGIPTDPVWTYVQRWTFARPEQPRERTY
FT                   FLGQARVGLAGDGWGEPRVESAWRSGTELARAIAEAVG"
     MAKVIVAGGG IAGVACAREL RARGISVEVR DRGRVIGGRM ASRWIDGRIV DAGASYFTAR        60
     SPEFLEVVDD WLIRGLVRPW THRFPVIDGP SATLSEPVPG PLRYAAPHGI RSLVADLATR       120
     GGLRVSQSSP IGMVRPGPVV DGEPVDAVVL AMPDPQALRH LDPDLDTERT ELIGRRWSPA       180
     LALLAGWEAR GWPPLDGAFV HGDPTVVWIA DDGRRRGDNA PVLVAHSTAE FAAGRLTDPR       240
     AAAGDLTAAL RRLLGIPTDP VWTYVQRWTF ARPEQPRERT YFLGQARVGL AGDGWGEPRV       300
     ESAWRSGTEL ARAIAEAVG                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page