(data stored in ACNUC7421 zone)

EMBL: CP000820.PE159

CP000820.PE159       Location/Qualifiers
FT   CDS             191566..192531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0161"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG:
FT                   fal:FRAAL6720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09628"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCI9"
FT                   /protein_id="ABW09628.1"
FT                   /translation="MPAVGPRQPCPCGSGRRYKACHGERRRAAPVLRPFAGRADEPDLV
FT                   ALREFVPSATAPLTLSAEHLTAHPGHADRRIILGTLLPQAAPAVVRDDGEILLAMQTLV
FT                   GGLDASADVAGALIAALEAKPGTVVDGGPASAPQAVERLPGGLADLPRLADLLDPAPLE
FT                   ITVHPGFTWWVPSSEDAEPSADVVATLDRANATVVPTTRLTSVPAAYWCSPGDRLHLRW
FT                   VLPLDADRTEEALLDALARLAAAGSLSVGEGSRFVGSFRADGLVVPVWDLAPGADADSC
FT                   EKPAAQLWTALRETLDDQRELTAQERRVRAGVVGRTLTLR"
     MPAVGPRQPC PCGSGRRYKA CHGERRRAAP VLRPFAGRAD EPDLVALREF VPSATAPLTL        60
     SAEHLTAHPG HADRRIILGT LLPQAAPAVV RDDGEILLAM QTLVGGLDAS ADVAGALIAA       120
     LEAKPGTVVD GGPASAPQAV ERLPGGLADL PRLADLLDPA PLEITVHPGF TWWVPSSEDA       180
     EPSADVVATL DRANATVVPT TRLTSVPAAY WCSPGDRLHL RWVLPLDADR TEEALLDALA       240
     RLAAAGSLSV GEGSRFVGSF RADGLVVPVW DLAPGADADS CEKPAAQLWT ALRETLDDQR       300
     ELTAQERRVR AGVVGRTLTL R                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page