(data stored in ACNUC7421 zone)

EMBL: CP000820.PE161

CP000820.PE161       Location/Qualifiers
FT   CDS             complement(193839..196154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6717 conserved hypothetical protein;
FT                   putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09630"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCJ1"
FT                   /protein_id="ABW09630.1"
FT                   /translation="MSVVEVTGPHDAHRHDAHRHDARRHDAAASYGASTYDVSAVHSPP
FT                   PGGGPHGGAGQHGVAGQHGSPYGAHSREVRPQGWSVGGPDDAIEVGGPGGFDDPPPRAQ
FT                   RHHQAPVRPPAADPGRQIWTGDPPAPTAAPVDPWRDGAAPAPSYGRERPGSWQQARGDR
FT                   PAAPMPPVPPPTEAMRPPPPPTEAMSLGPATEAMPLPPPTGGLPLGSLPGPPAPGIDTW
FT                   PSIRPAFRDPTPPPPPAEQPPRPGHVIDGVATRTFDPIHDRFPPAPGIASRPGPTPVET
FT                   TGEYRPSTLYPAPPPPPGATGASPIPRTDPQTSGRVASWLRDPVGPPALPPARPQSAPP
FT                   ASPPGPAGTGPGLYRDDAPDQAGRGWGHGFHSGPAYGAGMPGAGIHGSEIHGSEIDSAG
FT                   INSAGMRGVDVRSAEMHAAEMHGIEMRHDPMPGDRVDADDVHDRSWPREQTWPPDEYGP
FT                   RGDPRYDDPRSGTGLPPAALLPASPDTASRGWRRLVYQVSAGALNPGPSPDEARYRRLL
FT                   ARIRTPLDDCHRIAVLSLKGGVGKTTTTVSLGSTLASLRGDRVVAIDANPDRGTLGVRV
FT                   ERTTRHTVRDLLADADQLHRYVDVRRYLSQSASRLEVLASASDPEISDAFADEDYRAVD
FT                   DLLQRHYSILLTDCGTGMLHSAMHGVLELADTLVIVSNASADGGASASATLDWLDAHGY
FT                   NDHVSEAVTVISMFPQQGETVDVDALEDHFASRTRQVVRVPFDPHLASGGHIVLDELRR
FT                   ETRRAYEEIAGAVAERFG"
     MSVVEVTGPH DAHRHDAHRH DARRHDAAAS YGASTYDVSA VHSPPPGGGP HGGAGQHGVA        60
     GQHGSPYGAH SREVRPQGWS VGGPDDAIEV GGPGGFDDPP PRAQRHHQAP VRPPAADPGR       120
     QIWTGDPPAP TAAPVDPWRD GAAPAPSYGR ERPGSWQQAR GDRPAAPMPP VPPPTEAMRP       180
     PPPPTEAMSL GPATEAMPLP PPTGGLPLGS LPGPPAPGID TWPSIRPAFR DPTPPPPPAE       240
     QPPRPGHVID GVATRTFDPI HDRFPPAPGI ASRPGPTPVE TTGEYRPSTL YPAPPPPPGA       300
     TGASPIPRTD PQTSGRVASW LRDPVGPPAL PPARPQSAPP ASPPGPAGTG PGLYRDDAPD       360
     QAGRGWGHGF HSGPAYGAGM PGAGIHGSEI HGSEIDSAGI NSAGMRGVDV RSAEMHAAEM       420
     HGIEMRHDPM PGDRVDADDV HDRSWPREQT WPPDEYGPRG DPRYDDPRSG TGLPPAALLP       480
     ASPDTASRGW RRLVYQVSAG ALNPGPSPDE ARYRRLLARI RTPLDDCHRI AVLSLKGGVG       540
     KTTTTVSLGS TLASLRGDRV VAIDANPDRG TLGVRVERTT RHTVRDLLAD ADQLHRYVDV       600
     RRYLSQSASR LEVLASASDP EISDAFADED YRAVDDLLQR HYSILLTDCG TGMLHSAMHG       660
     VLELADTLVI VSNASADGGA SASATLDWLD AHGYNDHVSE AVTVISMFPQ QGETVDVDAL       720
     EDHFASRTRQ VVRVPFDPHL ASGGHIVLDE LRRETRRAYE EIAGAVAERF G                771
//

If you have problems or comments...

PBIL Back to PBIL home page