(data stored in ACNUC7421 zone)

EMBL: CP000820.PE168

CP000820.PE168       Location/Qualifiers
FT   CDS             203792..204229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6707 hypothetical protein; putative
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09637"
FT                   /db_xref="GOA:A8LCJ8"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCJ8"
FT                   /protein_id="ABW09637.1"
FT                   /translation="MRPTHIRDLLAIAVAVGAVVYALLWWSYQSLPQLPATASVSVLLV
FT                   GLIELQTASLTRRRLAGRPGTRPILPLTVARLAALAKATSVVAAVLAGGWTALLAYTAP
FT                   RTDEFGTAGGDALAAGLGLSATVVLLAGGLVLERVCRIRDR"
     MRPTHIRDLL AIAVAVGAVV YALLWWSYQS LPQLPATASV SVLLVGLIEL QTASLTRRRL        60
     AGRPGTRPIL PLTVARLAAL AKATSVVAAV LAGGWTALLA YTAPRTDEFG TAGGDALAAG       120
     LGLSATVVLL AGGLVLERVC RIRDR                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page