(data stored in ACNUC7421 zone)

EMBL: CP000820.PE169

CP000820.PE169       Location/Qualifiers
FT   CDS             204568..205695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0171"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6706 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09638"
FT                   /db_xref="GOA:A8LCJ9"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCJ9"
FT                   /protein_id="ABW09638.1"
FT                   /translation="MVAQGRGSPAEPGAGRAGAGGGTDHVPFEDDQRPGAGRSGGAASG
FT                   PRQSVGVGRPRQAGARLVTFGNLRTSGPGTDPGAAPPPVPLQPAAPSSPRFSPDGFPSG
FT                   YGPPADGPPADGPPSHGPVGYGPPVYGSPGAGRTGGAPSGFDPADMVTAPATDGPVRSA
FT                   PAGPRSVRPQPPGPRRDRTPPPFSPGVDDDELTTRPSVGRPPGPARPSGLEHARAAGPA
FT                   PVRAAGPGPVRATGPGPVRAAGLEPRRAAGLEPVSTTGYQERVADHPPDGYSVPGAGYR
FT                   GVPDEGYRRPGELHELPRRFDHDPDEAPAPAPRRRRNPVLTLVKIVLVGAMIVIGVSVG
FT                   RALALPGDQGSLSRMADWARDNHLSVVVDQVDRLR"
     MVAQGRGSPA EPGAGRAGAG GGTDHVPFED DQRPGAGRSG GAASGPRQSV GVGRPRQAGA        60
     RLVTFGNLRT SGPGTDPGAA PPPVPLQPAA PSSPRFSPDG FPSGYGPPAD GPPADGPPSH       120
     GPVGYGPPVY GSPGAGRTGG APSGFDPADM VTAPATDGPV RSAPAGPRSV RPQPPGPRRD       180
     RTPPPFSPGV DDDELTTRPS VGRPPGPARP SGLEHARAAG PAPVRAAGPG PVRATGPGPV       240
     RAAGLEPRRA AGLEPVSTTG YQERVADHPP DGYSVPGAGY RGVPDEGYRR PGELHELPRR       300
     FDHDPDEAPA PAPRRRRNPV LTLVKIVLVG AMIVIGVSVG RALALPGDQG SLSRMADWAR       360
     DNHLSVVVDQ VDRLR                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page