(data stored in ACNUC7421 zone)

EMBL: CP000820.PE17

CP000820.PE17        Location/Qualifiers
FT   CDS             23241..24332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0017"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   fal:FRAAL0031 conserved hypothetical protein; putative
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09486"
FT                   /db_xref="GOA:A8KX43"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX43"
FT                   /protein_id="ABW09486.1"
FT                   /translation="MTTFASNTLALGPDFISADSLAKAGLVVVLLIVFAESGLLVGFFL
FT                   PGDSLLFTLGLLISQDEVSTPLWLACALIGVAAVAGDQVGYLFGRKAGPALFRRPDSRL
FT                   FRQEYVDQAHEFFEKHGGRSIVLARFVPIVRTFTPVIAGVSRMNYRTFVVYNVIGGLLW
FT                   GCGVTVLGSLLGKIDFIRQNLEAMLILIVLISVVPILIEYLRARRTKATTGDAAGSPDA
FT                   TNAAGTGPAGPAAGHGPAWVDGPVREHDRAPGAGFAGGYESTGGYQPAGGYQGGYQPVD
FT                   VYQSADGYRNADGWQPESRYDDGRYDQPRAGTAGAAGHGGHGYDTEGFQDARPREGEAP
FT                   IQEERGPAGRRGGGGRHSAPRHR"
     MTTFASNTLA LGPDFISADS LAKAGLVVVL LIVFAESGLL VGFFLPGDSL LFTLGLLISQ        60
     DEVSTPLWLA CALIGVAAVA GDQVGYLFGR KAGPALFRRP DSRLFRQEYV DQAHEFFEKH       120
     GGRSIVLARF VPIVRTFTPV IAGVSRMNYR TFVVYNVIGG LLWGCGVTVL GSLLGKIDFI       180
     RQNLEAMLIL IVLISVVPIL IEYLRARRTK ATTGDAAGSP DATNAAGTGP AGPAAGHGPA       240
     WVDGPVREHD RAPGAGFAGG YESTGGYQPA GGYQGGYQPV DVYQSADGYR NADGWQPESR       300
     YDDGRYDQPR AGTAGAAGHG GHGYDTEGFQ DARPREGEAP IQEERGPAGR RGGGGRHSAP       360
     RHR                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page