(data stored in ACNUC7421 zone)

EMBL: CP000820.PE172

CP000820.PE172       Location/Qualifiers
FT   CDS             complement(210311..210904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0174"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   fal:FRAAL6702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09641"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCK2"
FT                   /protein_id="ABW09641.1"
FT                   /translation="MSTVVQAPTPLRSHRPTLTLPAPPVSVADLDATALEDARVEVLDG
FT                   LCVTRPWPTPLRARVTDRLRALLAQAATSGAQVFTGVQVELSPRCLLVPDVAVVAVGDP
FT                   DRRRITETPFGVVEVADASTRRYDRTLKLDVYREHGVPVCWLVDPDSATIEAFELVGRD
FT                   YVPAGIVCGDEELSVLRPFPVTVTPAELIDPPDD"
     MSTVVQAPTP LRSHRPTLTL PAPPVSVADL DATALEDARV EVLDGLCVTR PWPTPLRARV        60
     TDRLRALLAQ AATSGAQVFT GVQVELSPRC LLVPDVAVVA VGDPDRRRIT ETPFGVVEVA       120
     DASTRRYDRT LKLDVYREHG VPVCWLVDPD SATIEAFELV GRDYVPAGIV CGDEELSVLR       180
     PFPVTVTPAE LIDPPDD                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page