(data stored in ACNUC7421 zone)

EMBL: CP000820.PE175

CP000820.PE175       Location/Qualifiers
FT   CDS             215413..216213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0177"
FT                   /product="Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /note="PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3; KEGG: fal:FRAAL6699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09644"
FT                   /db_xref="GOA:A8LCK5"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCK5"
FT                   /protein_id="ABW09644.1"
FT                   /translation="MSVRVVYTDLDGTMVGPRGCFFRAEGGDTTLDPARALVDLHDAGI
FT                   ALVLVSGRTRPQLVEAAGIFGADGFIGELGAIIGWNTGLDTEILRGAMPDSFERVPESL
FT                   LDELTKLHPGRLELHTPWHTGREVDVMLRGRIDVAEVDGWLAESGFGWLSMRDNGLISP
FT                   AHMPDLGVHPHVYHLVPDGVSKGDAVAHDLKRRGVDPAEAIAIGDSASDLAMARSVGRM
FT                   HLVANAVRHPDIAALLPAYDNVVVEDGPLGAGWATAVRAALGAG"
     MSVRVVYTDL DGTMVGPRGC FFRAEGGDTT LDPARALVDL HDAGIALVLV SGRTRPQLVE        60
     AAGIFGADGF IGELGAIIGW NTGLDTEILR GAMPDSFERV PESLLDELTK LHPGRLELHT       120
     PWHTGREVDV MLRGRIDVAE VDGWLAESGF GWLSMRDNGL ISPAHMPDLG VHPHVYHLVP       180
     DGVSKGDAVA HDLKRRGVDP AEAIAIGDSA SDLAMARSVG RMHLVANAVR HPDIAALLPA       240
     YDNVVVEDGP LGAGWATAVR AALGAG                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page