(data stored in ACNUC7421 zone)

EMBL: CP000820.PE187

CP000820.PE187       Location/Qualifiers
FT   CDS             complement(231593..233140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0189"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: fal:FRAAL6682
FT                   conserved hypothetical protein; putative metallo-dependent
FT                   phosphatase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09656"
FT                   /db_xref="GOA:A8LCL7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR015914"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCL7"
FT                   /protein_id="ABW09656.1"
FT                   /translation="MPHSLRGPRRSRSRSSESPASAPRDAAPRDAPPRPGGGPSHAEHG
FT                   VHLAFGADPATSMVVSWITREPVVRPLARVVTGTAEAVREVEAGTRSYTDAATGWEIYA
FT                   HHALLDELAPDTEYTYEITYQTTAAGVVREVGRASFRTAPRGRAAFTFACFGDHGTDAS
FT                   DNPFGTPASGALVAGVERVDPLFTLVDGDLAYSNVSDVPPRAWADWFAMISTSAARRPW
FT                   MPSVGNHETERGNGALGLAAYQTYFQPPDNGEEPYLAGLWYAFTVGGVRFVVLSGDDVC
FT                   YQDAGRVYLHGYSSGRQTAWLERQLAEARADQAVDWIIVALHQAAVSTAEFHNGADLGL
FT                   REAWLPLFDQYGVDLVISGHEHHYERTHPLRGVVDGSTTLTPRPVPGSVSVAGGGGGGT
FT                   ATLDTSAGTVHMLIGTGGSSTPSAGQLFDPPACRVVVGVREREPGQRQRSSIRAVEPAP
FT                   WLAARFPEHPYAFAALTVDPGEPGGTTRIQVTVYDSADAVPVPFDTFTLARPRADAT"
     MPHSLRGPRR SRSRSSESPA SAPRDAAPRD APPRPGGGPS HAEHGVHLAF GADPATSMVV        60
     SWITREPVVR PLARVVTGTA EAVREVEAGT RSYTDAATGW EIYAHHALLD ELAPDTEYTY       120
     EITYQTTAAG VVREVGRASF RTAPRGRAAF TFACFGDHGT DASDNPFGTP ASGALVAGVE       180
     RVDPLFTLVD GDLAYSNVSD VPPRAWADWF AMISTSAARR PWMPSVGNHE TERGNGALGL       240
     AAYQTYFQPP DNGEEPYLAG LWYAFTVGGV RFVVLSGDDV CYQDAGRVYL HGYSSGRQTA       300
     WLERQLAEAR ADQAVDWIIV ALHQAAVSTA EFHNGADLGL REAWLPLFDQ YGVDLVISGH       360
     EHHYERTHPL RGVVDGSTTL TPRPVPGSVS VAGGGGGGTA TLDTSAGTVH MLIGTGGSST       420
     PSAGQLFDPP ACRVVVGVRE REPGQRQRSS IRAVEPAPWL AARFPEHPYA FAALTVDPGE       480
     PGGTTRIQVT VYDSADAVPV PFDTFTLARP RADAT                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page