(data stored in ACNUC7421 zone)

EMBL: CP000820.PE19

CP000820.PE19        Location/Qualifiers
FT   CDS             25136..25678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0019"
FT                   /product="PEBP family protein"
FT                   /note="PFAM: PEBP family protein; KEGG: fal:FRAAL0033 Raf
FT                   kinase inhibitor homologous protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09488"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX45"
FT                   /protein_id="ABW09488.1"
FT                   /translation="MSLLDRNTAPDPLDLLPPLPSFSLSSDDLTDGSPLGLDQVFSGAG
FT                   GADLSPHLSWTGFPAQTESFAVTCFDPDAPTGSGFWHWVLVDVPASVTELARGAGSGDL
FT                   SGLPAGAYHVRNDWGTANYGGAAPPEGDRPHRYVFVVHAVDVPKLEIDATVAPAVVGFN
FT                   LTFHTLARAVLRATYQR"
     MSLLDRNTAP DPLDLLPPLP SFSLSSDDLT DGSPLGLDQV FSGAGGADLS PHLSWTGFPA        60
     QTESFAVTCF DPDAPTGSGF WHWVLVDVPA SVTELARGAG SGDLSGLPAG AYHVRNDWGT       120
     ANYGGAAPPE GDRPHRYVFV VHAVDVPKLE IDATVAPAVV GFNLTFHTLA RAVLRATYQR       180
//

If you have problems or comments...

PBIL Back to PBIL home page