(data stored in ACNUC7421 zone)

EMBL: CP000820.PE199

CP000820.PE199       Location/Qualifiers
FT   CDS             complement(246842..249385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0201"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: fal:FRAAL6669
FT                   hypothetical protein; putative multidrug efflux transporter
FT                   AcrB transmembrane domains"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09668"
FT                   /db_xref="GOA:A8LCM9"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCM9"
FT                   /protein_id="ABW09668.1"
FT                   /translation="MRTRPPTASTPRRSPAPSGSGASDGPADRGPRHAHRAAPTSASPD
FT                   SPTHATHLAARAARWSVRHRRLAIGGWILGVVLVTLLGSLIGTSTLGDDDYSVGEDGRA
FT                   QSTLDAHGFTSPANENVLIQRPAQAASPEELLADPELRAALADVAARLDGTGEVTNLRA
FT                   PIALPGVEANPGLVSTDRRSVMVTFEMRGDEDTATDRIDPVLAAVAAAADEHPGLLVEE
FT                   VGEASADKALGDTIGKDFKRAELLAIPLTLGILLAVFGAVVAALVPVALALTAFVGALG
FT                   VVAFTSRLLPTDETATSVMLLIGLAVGVDYALFYIRREREERAAGHSPQRALEIAADTS
FT                   GHAVLVSGLTVAVSMAGLLLTGLSVFSGIAGGTVIVVLIAVLGSLTVLPAVLSWLGDRV
FT                   ELLRLPWHRRADARAAAAGAPGADRKTTSSTTSTTSVAGTAGVDLTRPGLMGRLLRRPG
FT                   IVAVVTGGLLILLAVPALGLRTVEPGMDDIPDDLPIMQTYDRVQAAFPGEQTAAVVVVS
FT                   AADVRAPQAVGAIDALRERALASGMMYEPITTEISADGQVAKISIPIAGGGTDDASLRV
FT                   LDTLRGEIIPSTIDPVSGMSADVTGWTAGSADFNAQLNGRTPLVIGFVLVLAFLLLLAA
FT                   FRSAIVAAAAVALNLLSVAAAYGLLVVVFQHHWADGLLGYTSTGAITNWLPLMLFVILF
FT                   GLSMDYQVFVLSRVREAYDSGLPMRDAVLVGVRRSAGVVTSAAVIMVAVFSIFATLSQV
FT                   SMKQLGVGLGAAILLDATVIRVILMPAVLTLIGERAWRRRPAADDDDRGTAVPVPAGDR
FT                   RPQLPAQAPAPAAPPAPAGHGPFSGMGDFPRHRQD"
     MRTRPPTAST PRRSPAPSGS GASDGPADRG PRHAHRAAPT SASPDSPTHA THLAARAARW        60
     SVRHRRLAIG GWILGVVLVT LLGSLIGTST LGDDDYSVGE DGRAQSTLDA HGFTSPANEN       120
     VLIQRPAQAA SPEELLADPE LRAALADVAA RLDGTGEVTN LRAPIALPGV EANPGLVSTD       180
     RRSVMVTFEM RGDEDTATDR IDPVLAAVAA AADEHPGLLV EEVGEASADK ALGDTIGKDF       240
     KRAELLAIPL TLGILLAVFG AVVAALVPVA LALTAFVGAL GVVAFTSRLL PTDETATSVM       300
     LLIGLAVGVD YALFYIRRER EERAAGHSPQ RALEIAADTS GHAVLVSGLT VAVSMAGLLL       360
     TGLSVFSGIA GGTVIVVLIA VLGSLTVLPA VLSWLGDRVE LLRLPWHRRA DARAAAAGAP       420
     GADRKTTSST TSTTSVAGTA GVDLTRPGLM GRLLRRPGIV AVVTGGLLIL LAVPALGLRT       480
     VEPGMDDIPD DLPIMQTYDR VQAAFPGEQT AAVVVVSAAD VRAPQAVGAI DALRERALAS       540
     GMMYEPITTE ISADGQVAKI SIPIAGGGTD DASLRVLDTL RGEIIPSTID PVSGMSADVT       600
     GWTAGSADFN AQLNGRTPLV IGFVLVLAFL LLLAAFRSAI VAAAAVALNL LSVAAAYGLL       660
     VVVFQHHWAD GLLGYTSTGA ITNWLPLMLF VILFGLSMDY QVFVLSRVRE AYDSGLPMRD       720
     AVLVGVRRSA GVVTSAAVIM VAVFSIFATL SQVSMKQLGV GLGAAILLDA TVIRVILMPA       780
     VLTLIGERAW RRRPAADDDD RGTAVPVPAG DRRPQLPAQA PAPAAPPAPA GHGPFSGMGD       840
     FPRHRQD                                                                 847
//

If you have problems or comments...

PBIL Back to PBIL home page