(data stored in ACNUC7421 zone)

EMBL: CP000820.PE2

CP000820.PE2         Location/Qualifiers
FT   CDS             2937..3959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0002"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hsa:23524 serine/arginine repetitive matrix 2"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09471"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB17"
FT                   /protein_id="ABW09471.1"
FT                   /translation="MDERVYSLCASEGHLWNRSSPGDKPLDHPHRHPQDAHRASVGLTW
FT                   ENGRFPQFPQPLLLLRTRSSSERSKPRSSRSWGQPRISIMVWPGCPKRAHGAMRSLPSV
FT                   SRLPVGASRETSTAVRESSLRCAARGRITDAGPHDQRHRCDRWHQRDRCGPWLRRCDRR
FT                   TPDPPRGWRSSSHRCGRRLQRGTRQPVIRRGRRSRRMRSEVLMRSCGTVVSGSCGGAVV
FT                   PGEMRKITPDTPDAGDLQAPPRQSAVRSARHGSSIGRCRGCARSSSPVCHPRNTDHPPP
FT                   ARGALGCWIGSGWCSTARSLPTRRVARVRCSARRSYAGDVKFRERPWERPPRDDGRTCP
FT                   "
     MDERVYSLCA SEGHLWNRSS PGDKPLDHPH RHPQDAHRAS VGLTWENGRF PQFPQPLLLL        60
     RTRSSSERSK PRSSRSWGQP RISIMVWPGC PKRAHGAMRS LPSVSRLPVG ASRETSTAVR       120
     ESSLRCAARG RITDAGPHDQ RHRCDRWHQR DRCGPWLRRC DRRTPDPPRG WRSSSHRCGR       180
     RLQRGTRQPV IRRGRRSRRM RSEVLMRSCG TVVSGSCGGA VVPGEMRKIT PDTPDAGDLQ       240
     APPRQSAVRS ARHGSSIGRC RGCARSSSPV CHPRNTDHPP PARGALGCWI GSGWCSTARS       300
     LPTRRVARVR CSARRSYAGD VKFRERPWER PPRDDGRTCP                             340
//

If you have problems or comments...

PBIL Back to PBIL home page