(data stored in ACNUC7421 zone)

EMBL: CP000820.PE201

CP000820.PE201       Location/Qualifiers
FT   CDS             250592..251191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0203"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO6333 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09670"
FT                   /db_xref="GOA:A8LCN1"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCN1"
FT                   /protein_id="ABW09670.1"
FT                   /translation="MASAGDTAGGSTADGAFRAAARAILFPPTGHPRHAVYGTVLAAGL
FT                   IAAQDPDQDSAAEIIAAVATTMVVFWLAHGYAHAIGHRVRRDTGDGIGRVADRRAGSDA
FT                   GSDAGWPGARRALVENWPMVRASFLPLAVLAVARAAGASVSDAQEAALWTSLLLLCAWG
FT                   LFSGRAGGLRRWRLAGYTAGIALLGIILIGLEVAIH"
     MASAGDTAGG STADGAFRAA ARAILFPPTG HPRHAVYGTV LAAGLIAAQD PDQDSAAEII        60
     AAVATTMVVF WLAHGYAHAI GHRVRRDTGD GIGRVADRRA GSDAGSDAGW PGARRALVEN       120
     WPMVRASFLP LAVLAVARAA GASVSDAQEA ALWTSLLLLC AWGLFSGRAG GLRRWRLAGY       180
     TAGIALLGII LIGLEVAIH                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page