(data stored in ACNUC7421 zone)

EMBL: CP000820.PE202

CP000820.PE202       Location/Qualifiers
FT   CDS             251195..251440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09671"
FT                   /db_xref="GOA:A8LCN2"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCN2"
FT                   /protein_id="ABW09671.1"
FT                   /translation="MLRSSRQPPGVAGIRASVKVRCGGGWLGSGPGRSGPILALGYSPF
FT                   RFFLAVSGGFFGRTLPERARRMSKGEQATGVCGVDP"
     MLRSSRQPPG VAGIRASVKV RCGGGWLGSG PGRSGPILAL GYSPFRFFLA VSGGFFGRTL        60
     PERARRMSKG EQATGVCGVD P                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page