(data stored in ACNUC7421 zone)

EMBL: CP000820.PE203

CP000820.PE203       Location/Qualifiers
FT   CDS             251873..252466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL4952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09672"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDQ7"
FT                   /protein_id="ABW09672.1"
FT                   /translation="MSRHDPALARALAVACRQKGALTRVQARCAGLTDHRLHQLVQNED
FT                   WLNPVQGGYVVPTCDTYLGRCQAALLVLPCATLCGLTAARLHEFPTLPPRSDDEPIHLL
FT                   LPPGSSRRRNKGVVLWYDAMSAEQQEQVHGLRATSVARTLVDLLASGPRDTAASLLDRA
FT                   VEGGLVAPEELDELRGALDAQPEATRPDPVRPDT"
     MSRHDPALAR ALAVACRQKG ALTRVQARCA GLTDHRLHQL VQNEDWLNPV QGGYVVPTCD        60
     TYLGRCQAAL LVLPCATLCG LTAARLHEFP TLPPRSDDEP IHLLLPPGSS RRRNKGVVLW       120
     YDAMSAEQQE QVHGLRATSV ARTLVDLLAS GPRDTAASLL DRAVEGGLVA PEELDELRGA       180
     LDAQPEATRP DPVRPDT                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page