(data stored in ACNUC7421 zone)

EMBL: CP000820.PE208

CP000820.PE208       Location/Qualifiers
FT   CDS             complement(256145..257083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09677"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDR2"
FT                   /protein_id="ABW09677.1"
FT                   /translation="MAGYPSQASWDDEHADGADGAGSEITNETLATARPSTELEPATAP
FT                   RQPGPARWSPTVHPDHPLRRGIDPATWPVGFSPTGEALPEALTDVLLRGSHAIRSSKRA
FT                   EAQRLERAAAIAEHVQAQIDDFLGFCAAERLTPPVIVRTNGRRAERSHDDVPDWNGTPR
FT                   LRTSTTGRAAARAGEDGSRQDRRRGEDDADPDTASPPPTGRHGRRSGTTPARRRLLRRE
FT                   RLHAWPLLYWRCESFPAPGRSLHLFVEPDGRTFEGRDAPAPLTVLGREVQVWPVDAPSI
FT                   VEGMAEVDARRCALHLVHGMAHMLWQAGVGL"
     MAGYPSQASW DDEHADGADG AGSEITNETL ATARPSTELE PATAPRQPGP ARWSPTVHPD        60
     HPLRRGIDPA TWPVGFSPTG EALPEALTDV LLRGSHAIRS SKRAEAQRLE RAAAIAEHVQ       120
     AQIDDFLGFC AAERLTPPVI VRTNGRRAER SHDDVPDWNG TPRLRTSTTG RAAARAGEDG       180
     SRQDRRRGED DADPDTASPP PTGRHGRRSG TTPARRRLLR RERLHAWPLL YWRCESFPAP       240
     GRSLHLFVEP DGRTFEGRDA PAPLTVLGRE VQVWPVDAPS IVEGMAEVDA RRCALHLVHG       300
     MAHMLWQAGV GL                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page