(data stored in ACNUC7421 zone)

EMBL: CP000820.PE211

CP000820.PE211       Location/Qualifiers
FT   CDS             complement(260033..260776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0213"
FT                   /product="Transglycosylase domain protein"
FT                   /note="PFAM: Transglycosylase domain protein; KEGG:
FT                   fal:FRAAL6658 hypothetical protein; putative signal
FT                   peptide; putative lysozyme-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09680"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDR5"
FT                   /protein_id="ABW09680.1"
FT                   /translation="MRSHDRVPARSNGRGGRHRATQGPSTATRVLRTTGAVTALVGTGL
FT                   AVTAAPAGAATADDFAKLRKCESGGNYAINTGNGFYGAYQFDQRTWTGLGYPGRPDQAP
FT                   PAMQDEAAYKLYDSRGWSPWPGCTSKLGLTRNGPAPASSGAGGDVIAQALTPAEPPMTL
FT                   ERARAEVGGQFGGEVLNVGMGDDVRADAFIWQAEMRDRRFVLTVDGKFGPESQGIAALY
FT                   SYLTRVSDGQPGVVGQNLWNATVSG"
     MRSHDRVPAR SNGRGGRHRA TQGPSTATRV LRTTGAVTAL VGTGLAVTAA PAGAATADDF        60
     AKLRKCESGG NYAINTGNGF YGAYQFDQRT WTGLGYPGRP DQAPPAMQDE AAYKLYDSRG       120
     WSPWPGCTSK LGLTRNGPAP ASSGAGGDVI AQALTPAEPP MTLERARAEV GGQFGGEVLN       180
     VGMGDDVRAD AFIWQAEMRD RRFVLTVDGK FGPESQGIAA LYSYLTRVSD GQPGVVGQNL       240
     WNATVSG                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page