(data stored in ACNUC7421 zone)

EMBL: CP000820.PE212

CP000820.PE212       Location/Qualifiers
FT   CDS             complement(261118..261900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0214"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ago:AGOS_ADL112W ADL112Wp"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09681"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDR6"
FT                   /protein_id="ABW09681.1"
FT                   /translation="MFQLRPAGVSPDIPPAADHVLSQPRFPHQHELGTLRRPGSSAAKT
FT                   RRRQDRMTRPHGADPAVRAGAVRGSPQRSARHGRRYGLRRQAGVEVPMPGAVFSSVIHP
FT                   MIGRTLRQPSRRGARPTADSARSSPPHDLLRPRPQEEPSTPVIPAGGRVPHRPGHARRG
FT                   RPARSRRPCRSSLRRAPCPRAHNPINLHLVTSDIQNVIILEKTTNERQTYFRGAVETRR
FT                   HAARPTPEDVRPRPGGNVIRISASSHNRLRHSSISPFG"
     MFQLRPAGVS PDIPPAADHV LSQPRFPHQH ELGTLRRPGS SAAKTRRRQD RMTRPHGADP        60
     AVRAGAVRGS PQRSARHGRR YGLRRQAGVE VPMPGAVFSS VIHPMIGRTL RQPSRRGARP       120
     TADSARSSPP HDLLRPRPQE EPSTPVIPAG GRVPHRPGHA RRGRPARSRR PCRSSLRRAP       180
     CPRAHNPINL HLVTSDIQNV IILEKTTNER QTYFRGAVET RRHAARPTPE DVRPRPGGNV       240
     IRISASSHNR LRHSSISPFG                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page