(data stored in ACNUC7421 zone)

EMBL: CP000820.PE220

CP000820.PE220       Location/Qualifiers
FT   CDS             270648..271739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09689"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS4"
FT                   /protein_id="ABW09689.1"
FT                   /translation="MSVDARREVPTGTRSSEVTYDHLIIPPHWRRPAGPGPGEPNPLFP
FT                   AGEQATAPPPGPAVTGASPINPMTGPMTGPLLVGTTARAFAKLDDMVRLGDDDRAVIDD
FT                   RRAEAERALRSIFPPRCALPLVGVATIGSAGRDTMIRPLDEVDIFVVFSAANSAWKRFR
FT                   WDSRDLLVCVRNAIGGDRVQTIGTRGQALRIVYDAAPDVHLVPAFDHPRAGYVIPDRVG
FT                   GWLPTRPERHASWTMDLGPRVISAVRLLKAWNRVCGSHLRSFHIEALAGQVLAGRGLNT
FT                   RQGLAEVFRHMDEVGLVVGDPSDIRGDLSSYLRQDDLEDLGAFVRQARTYSAKAVAAER
FT                   AGDHEEAVSLWGTVFGPEFPTFG"
     MSVDARREVP TGTRSSEVTY DHLIIPPHWR RPAGPGPGEP NPLFPAGEQA TAPPPGPAVT        60
     GASPINPMTG PMTGPLLVGT TARAFAKLDD MVRLGDDDRA VIDDRRAEAE RALRSIFPPR       120
     CALPLVGVAT IGSAGRDTMI RPLDEVDIFV VFSAANSAWK RFRWDSRDLL VCVRNAIGGD       180
     RVQTIGTRGQ ALRIVYDAAP DVHLVPAFDH PRAGYVIPDR VGGWLPTRPE RHASWTMDLG       240
     PRVISAVRLL KAWNRVCGSH LRSFHIEALA GQVLAGRGLN TRQGLAEVFR HMDEVGLVVG       300
     DPSDIRGDLS SYLRQDDLED LGAFVRQART YSAKAVAAER AGDHEEAVSL WGTVFGPEFP       360
     TFG                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page