(data stored in ACNUC7421 zone)

EMBL: CP000820.PE221

CP000820.PE221       Location/Qualifiers
FT   CDS             complement(271810..273219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0223"
FT                   /product="membrane-flanked domain"
FT                   /note="PFAM: membrane-flanked domain; KEGG: fal:FRAAL6648
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09690"
FT                   /db_xref="GOA:A8LDS5"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="InterPro:IPR014529"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS5"
FT                   /protein_id="ABW09690.1"
FT                   /translation="MTRAEPEPSVEDAAPPLQPPPAGAEPDDGYHHLHPLTPLLRGWLL
FT                   VAAVAVSILKNFAEELTVRSVTLTLSALLPAASAYGYCAWRFTRYRVEAEDLRLETGLL
FT                   IKRIRHVRLDRIQSVDVAQPLIARAAGLAVLRLDLAGTHDGDAEESGTRLSYLSLERAR
FT                   LLRAELLARAAGVAPGAGEAPERPLAYVPPLRLAAAITLSPAPWLALGAAFILVTPALL
FT                   TGTFAGFIAVAPALVGVWRTTFDRFATGFRFTVSESPDGLRIRGGLLDRAHHTVPHGRV
FT                   QAVSLRGSPLWRWLGWVELQINVAGDARSMLLPVAPRGQAVNVIERLLPAVDVDGMALP
FT                   RPPGRARLIAPVRWRRMRCGADDRVFVVRGGVLWQRTDIIPHGKVQSIRVVQHPAHRLL
FT                   RLADVHLDCAGGPVRIHARLLDVRQAHAIAAAQAERSRLSRVAAVPIVTGSPAWTPLRP
FT                   LSGARDPDAVH"
     MTRAEPEPSV EDAAPPLQPP PAGAEPDDGY HHLHPLTPLL RGWLLVAAVA VSILKNFAEE        60
     LTVRSVTLTL SALLPAASAY GYCAWRFTRY RVEAEDLRLE TGLLIKRIRH VRLDRIQSVD       120
     VAQPLIARAA GLAVLRLDLA GTHDGDAEES GTRLSYLSLE RARLLRAELL ARAAGVAPGA       180
     GEAPERPLAY VPPLRLAAAI TLSPAPWLAL GAAFILVTPA LLTGTFAGFI AVAPALVGVW       240
     RTTFDRFATG FRFTVSESPD GLRIRGGLLD RAHHTVPHGR VQAVSLRGSP LWRWLGWVEL       300
     QINVAGDARS MLLPVAPRGQ AVNVIERLLP AVDVDGMALP RPPGRARLIA PVRWRRMRCG       360
     ADDRVFVVRG GVLWQRTDII PHGKVQSIRV VQHPAHRLLR LADVHLDCAG GPVRIHARLL       420
     DVRQAHAIAA AQAERSRLSR VAAVPIVTGS PAWTPLRPLS GARDPDAVH                   469
//

If you have problems or comments...

PBIL Back to PBIL home page