(data stored in ACNUC7421 zone)

EMBL: CP000820.PE224

CP000820.PE224       Location/Qualifiers
FT   CDS             276572..277366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09693"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS8"
FT                   /protein_id="ABW09693.1"
FT                   /translation="MDVRNSGSWRPWRSGPASAGRGGLALAAAALVVASCQSGGSGAAG
FT                   IVPAATSAPPGPSQASVVSRTPAEPTLRAEDYVLTEGAITAGFTASPADPQSNSDDLTM
FT                   VQVAQCLGVPAEQFSDEHLDTADGPDFTSDVDELVTMSSSAQIVTEEKVAADLEILNNP
FT                   RFAECFGQTMQAEFDADTGSGATVEIVAAESPAPPAGASGLLRISMGVTAGGETVGLVL
FT                   DNVFFFEGQVEVVVNYANVDNTPPQVHLQRIADQISGKLQIQ"
     MDVRNSGSWR PWRSGPASAG RGGLALAAAA LVVASCQSGG SGAAGIVPAA TSAPPGPSQA        60
     SVVSRTPAEP TLRAEDYVLT EGAITAGFTA SPADPQSNSD DLTMVQVAQC LGVPAEQFSD       120
     EHLDTADGPD FTSDVDELVT MSSSAQIVTE EKVAADLEIL NNPRFAECFG QTMQAEFDAD       180
     TGSGATVEIV AAESPAPPAG ASGLLRISMG VTAGGETVGL VLDNVFFFEG QVEVVVNYAN       240
     VDNTPPQVHL QRIADQISGK LQIQ                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page