(data stored in ACNUC7421 zone)

EMBL: CP000820.PE225

CP000820.PE225       Location/Qualifiers
FT   CDS             complement(277387..278307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0227"
FT                   /product="Indigoidine synthase A family protein"
FT                   /note="PFAM: Indigoidine synthase A family protein; KEGG:
FT                   fal:FRAAL6645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09694"
FT                   /db_xref="GOA:A8LDS9"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS9"
FT                   /protein_id="ABW09694.1"
FT                   /translation="MISPGPGLAVSAEVSAALAAGRPVVALESTLIAHGLPRPRNRAVA
FT                   VELEEMLRERGVTPATVAVIDGVPTIGLDDATLSRVADDPAVAKASVRDLPAAAALRRT
FT                   CATTVASTSMLAARAGIRVFATGGLGGVHRGAGESFDESADLPTLGGTPITVVSAGVKS
FT                   ILDVGATLERMETLGITLLGWRTSEFPGFYLPGSGHRLDWRVDDARQVAGTMAARDRLG
FT                   LTSAIVVANPVPREQALDPGVHDRVLAEALRRAEAGGLRGKAVTPFLLETFRTETAGAS
FT                   LEVNVAVVRSNVAVAAEIATAWAAG"
     MISPGPGLAV SAEVSAALAA GRPVVALEST LIAHGLPRPR NRAVAVELEE MLRERGVTPA        60
     TVAVIDGVPT IGLDDATLSR VADDPAVAKA SVRDLPAAAA LRRTCATTVA STSMLAARAG       120
     IRVFATGGLG GVHRGAGESF DESADLPTLG GTPITVVSAG VKSILDVGAT LERMETLGIT       180
     LLGWRTSEFP GFYLPGSGHR LDWRVDDARQ VAGTMAARDR LGLTSAIVVA NPVPREQALD       240
     PGVHDRVLAE ALRRAEAGGL RGKAVTPFLL ETFRTETAGA SLEVNVAVVR SNVAVAAEIA       300
     TAWAAG                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page