(data stored in ACNUC7421 zone)

EMBL: CP000820.PE226

CP000820.PE226       Location/Qualifiers
FT   CDS             278506..279408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09695"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDT0"
FT                   /protein_id="ABW09695.1"
FT                   /translation="MTRRTILVVRVMKSAEIPRAGAPGRRPWIPGMSMALRAGVGLLAL
FT                   LVVATACTGGSSTRARGADRRSDSTDADVGVEDVNRGGTNGANGTGGRRTPSPAPSPLT
FT                   AADFVLTAGPETMGFSQDPPQPASGPNSVASAPSSMFDGTVATCAEATDAQIGASSTGD
FT                   ADGPVFTHDTSGADLRSFASVYADTATVAGHREIVRLDRFAGCYGRALVDELDSDELGA
FT                   TLIGTETVPPPPGATDRITVTIDIVTAQQQSFRTYVDLIMIFTGRAEGTITLVTPFQPA
FT                   DPALLATLTGQVERKIAAQ"
     MTRRTILVVR VMKSAEIPRA GAPGRRPWIP GMSMALRAGV GLLALLVVAT ACTGGSSTRA        60
     RGADRRSDST DADVGVEDVN RGGTNGANGT GGRRTPSPAP SPLTAADFVL TAGPETMGFS       120
     QDPPQPASGP NSVASAPSSM FDGTVATCAE ATDAQIGASS TGDADGPVFT HDTSGADLRS       180
     FASVYADTAT VAGHREIVRL DRFAGCYGRA LVDELDSDEL GATLIGTETV PPPPGATDRI       240
     TVTIDIVTAQ QQSFRTYVDL IMIFTGRAEG TITLVTPFQP ADPALLATLT GQVERKIAAQ       300
//

If you have problems or comments...

PBIL Back to PBIL home page