(data stored in ACNUC7421 zone)

EMBL: CP000820.PE23

CP000820.PE23        Location/Qualifiers
FT   CDS             complement(28203..29546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0023"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: fal:FRAAL6832 polyamine ABC-transporter
FT                   ATP-binding protein; TIGRFAM: spermidine/putrescine ABC
FT                   transporter ATPase subunit; PFAM: ABC transporter related;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09492"
FT                   /db_xref="GOA:A8LB31"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB31"
FT                   /protein_id="ABW09492.1"
FT                   /translation="MPSSLSTPMSSRRSREQWRGQRGGDPGRRRPRCARVPAGRIRRTL
FT                   APAIEFVGVAKEYSSRAGLVGAVSRVDLSIEQGEFFSLLGPSGCGKTTTLRMIAGFEEP
FT                   TRGRILLHGRDVTAVPPNRRDVNLVFQSYALFPHLDVASNVAFGLRRRGVRGQELRRRV
FT                   GEILELVELSGLADRRPRALSGGQQQRVALARALVNRPRALLLDEPLGALDLKLRQTMQ
FT                   IELKRIQREVGITFVYVTHDQSEALTMSDRIAVMNRGRVEQLAAPREIYERPGTRFVAG
FT                   FIGTSNLLRRSVRSVDPAGVDGTPVAVLDSAAEERLVVPLRPELGRPATGSELEMTVRP
FT                   EKITLGVTRPNGTCCALHGRVTEVVYLGTYTTYTVLTHGGSEITVFWQNSADATNIADR
FT                   GDEVWLSWLPTHSFALAPSAHAKSTPPSALAPSGSLREDQNHTEGLAS"
     MPSSLSTPMS SRRSREQWRG QRGGDPGRRR PRCARVPAGR IRRTLAPAIE FVGVAKEYSS        60
     RAGLVGAVSR VDLSIEQGEF FSLLGPSGCG KTTTLRMIAG FEEPTRGRIL LHGRDVTAVP       120
     PNRRDVNLVF QSYALFPHLD VASNVAFGLR RRGVRGQELR RRVGEILELV ELSGLADRRP       180
     RALSGGQQQR VALARALVNR PRALLLDEPL GALDLKLRQT MQIELKRIQR EVGITFVYVT       240
     HDQSEALTMS DRIAVMNRGR VEQLAAPREI YERPGTRFVA GFIGTSNLLR RSVRSVDPAG       300
     VDGTPVAVLD SAAEERLVVP LRPELGRPAT GSELEMTVRP EKITLGVTRP NGTCCALHGR       360
     VTEVVYLGTY TTYTVLTHGG SEITVFWQNS ADATNIADRG DEVWLSWLPT HSFALAPSAH       420
     AKSTPPSALA PSGSLREDQN HTEGLAS                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page