(data stored in ACNUC7421 zone)

EMBL: CP000820.PE230

CP000820.PE230       Location/Qualifiers
FT   CDS             complement(284442..285278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0232"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: fal:FRAAL6640 heat shock
FT                   protein (HSP-70 cofactor)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09699"
FT                   /db_xref="GOA:A8LDT4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDT4"
FT                   /protein_id="ABW09699.1"
FT                   /translation="MTSAHGEHRLDDSRAGGDGGPEEPIVKDRRRIDPETGQVRGSAAG
FT                   AATPGAEPMGPAGAGPADSDSELVASLRGQLGERTADLQRLKAEFDNYRRRAARERDAA
FT                   GDQAVSKLLGGLLGVLDDIGRARDHGDLEGPFKAIAESLETALESTGLERFGTPGEVFD
FT                   PHLHHALMHSYRSDVSETTCVEIFRAGYRRGNAVLRAAQVAVAEPSEDGGDALYEDGPD
FT                   AGISDRVTEVGPPGEYDAAEGQPAAGASPGRENAPLPDDTGSVPGPDRGGPTVSAD"
     MTSAHGEHRL DDSRAGGDGG PEEPIVKDRR RIDPETGQVR GSAAGAATPG AEPMGPAGAG        60
     PADSDSELVA SLRGQLGERT ADLQRLKAEF DNYRRRAARE RDAAGDQAVS KLLGGLLGVL       120
     DDIGRARDHG DLEGPFKAIA ESLETALEST GLERFGTPGE VFDPHLHHAL MHSYRSDVSE       180
     TTCVEIFRAG YRRGNAVLRA AQVAVAEPSE DGGDALYEDG PDAGISDRVT EVGPPGEYDA       240
     AEGQPAAGAS PGRENAPLPD DTGSVPGPDR GGPTVSAD                               278
//

If you have problems or comments...

PBIL Back to PBIL home page