(data stored in ACNUC7421 zone)

EMBL: CP000820.PE231

CP000820.PE231       Location/Qualifiers
FT   CDS             complement(285275..287113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0233"
FT                   /product="chaperone protein DnaK"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: fal:FRAAL6639 chaperone HSP70 in DNA
FT                   biosynthesis/cell division; TIGRFAM: chaperone protein
FT                   DnaK; PFAM: Heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09700"
FT                   /db_xref="GOA:A8LDT5"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDT5"
FT                   /protein_id="ABW09700.1"
FT                   /translation="MARAVGIDLGTTNSVVSVLEGGEPTVIANAEGSRTTPSVVAFAKN
FT                   GEVLVGEVAKRQAVTNVERTIRSVKRHMGTDWKMTVDSKEFTPQEISARILQKLKRDAE
FT                   AYLGESVSDAVITVPAYFDDAQRQATTEAGTIAGLNVLRIVNEPTAAALAYGLDKGEKE
FT                   QTILVFDLGGGTFDVSLLEIGDGVVEVKSTSGDTQLGGDDWDQRITDHLIKTFNGQHGV
FT                   DLGKDKMALQRLREAAEKAKIELSQSTQTSINLPYITASAEGPLHLDVSLSRAELQRMT
FT                   QDLIDRCKGPFQQAVKDAGIKISDVDHVVLVGGSTRMPAVVDLVRELTGGKEPNKGVNP
FT                   DEVVAVGASLQAGVLKGEVKDVLLLDVTPLSLGIETKGGIMTKLIERNTTIPTKRSEIF
FT                   TTAEDSQPSVQIQVFQGEREMAAYNKKLGMFELTGLPPAPRGMPQIEVTFDIDANGIVH
FT                   VSAKDLGTGKEQSMTITGGSALPKDDINRMVQDAEQYAEEDRQRREEAETRNRAESLVY
FT                   STERFLAENGDKIEAGVKSDVEEKLSTLRGAVGGTDIAAIREAADELTKASQAMGESMY
FT                   AQAAGAQGAPGAPGAGAGQADDDVVDAEIVDEEDKK"
     MARAVGIDLG TTNSVVSVLE GGEPTVIANA EGSRTTPSVV AFAKNGEVLV GEVAKRQAVT        60
     NVERTIRSVK RHMGTDWKMT VDSKEFTPQE ISARILQKLK RDAEAYLGES VSDAVITVPA       120
     YFDDAQRQAT TEAGTIAGLN VLRIVNEPTA AALAYGLDKG EKEQTILVFD LGGGTFDVSL       180
     LEIGDGVVEV KSTSGDTQLG GDDWDQRITD HLIKTFNGQH GVDLGKDKMA LQRLREAAEK       240
     AKIELSQSTQ TSINLPYITA SAEGPLHLDV SLSRAELQRM TQDLIDRCKG PFQQAVKDAG       300
     IKISDVDHVV LVGGSTRMPA VVDLVRELTG GKEPNKGVNP DEVVAVGASL QAGVLKGEVK       360
     DVLLLDVTPL SLGIETKGGI MTKLIERNTT IPTKRSEIFT TAEDSQPSVQ IQVFQGEREM       420
     AAYNKKLGMF ELTGLPPAPR GMPQIEVTFD IDANGIVHVS AKDLGTGKEQ SMTITGGSAL       480
     PKDDINRMVQ DAEQYAEEDR QRREEAETRN RAESLVYSTE RFLAENGDKI EAGVKSDVEE       540
     KLSTLRGAVG GTDIAAIREA ADELTKASQA MGESMYAQAA GAQGAPGAPG AGAGQADDDV       600
     VDAEIVDEED KK                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page