(data stored in ACNUC7421 zone)

EMBL: CP000820.PE232

CP000820.PE232       Location/Qualifiers
FT   CDS             complement(287131..287700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09701"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDT6"
FT                   /protein_id="ABW09701.1"
FT                   /translation="MGESWLSLNRRAFLDLAPPGAPGLSWRLLAVIGACPQAARPGAWR
FT                   LQSPAIPVTPDAPRPRGSRGGTGPASGVTSRPHKVILAVSDPASPSDGAILSGQDSGSP
FT                   GYPKSVHPESTVLKSAPGAGARDRNRVATRDSSATATPPQSHHQHPHHQHPHQRSRAHD
FT                   RRFGAGRSPGLTPTRASRRSPPGGPA"
     MGESWLSLNR RAFLDLAPPG APGLSWRLLA VIGACPQAAR PGAWRLQSPA IPVTPDAPRP        60
     RGSRGGTGPA SGVTSRPHKV ILAVSDPASP SDGAILSGQD SGSPGYPKSV HPESTVLKSA       120
     PGAGARDRNR VATRDSSATA TPPQSHHQHP HHQHPHQRSR AHDRRFGAGR SPGLTPTRAS       180
     RRSPPGGPA                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page