(data stored in ACNUC7421 zone)

EMBL: CP000820.PE233

CP000820.PE233       Location/Qualifiers
FT   CDS             complement(287881..289170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09702"
FT                   /db_xref="GOA:A8LDT7"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDT7"
FT                   /protein_id="ABW09702.1"
FT                   /translation="MATSTRPATPRAGRPGFSQHTEYLRARENQAMVRRDRLAREVPRA
FT                   AIRAAVVGMGLGLVIGFGLGLPGLGVAVFVVLLIVWPGGIAVAAFGVSPDVETLREAAE
FT                   AERKTARAISRLRRHGYVIMHDRAVPYSQATIGHLLIGPGGVMILGSDTNKGIVRYAKG
FT                   GAMVDGESLKPAIDKTSWLGGEVRNQVRAALPTTKIPVYPVLVMVEASVLWSDGALDGV
FT                   TIISVKDVVKYVRSKPGRLNPGQVQQVLAAAQRLFPPYSSNRLAEHVVVDRDQWLTLMD
FT                   ALRTIRERGGDASEMLERLAQIEADLGRQADLIDRAGMPLARAADQPDGPTDSPPPASG
FT                   TDTATDAIGLLDVDGTGTAKSLEGPPRARPGEGRRGRILAAVRQPRGSESISTSSRPPG
FT                   GDGPTTAKGDQPPAPGDDRAHPTSGPGSGS"
     MATSTRPATP RAGRPGFSQH TEYLRARENQ AMVRRDRLAR EVPRAAIRAA VVGMGLGLVI        60
     GFGLGLPGLG VAVFVVLLIV WPGGIAVAAF GVSPDVETLR EAAEAERKTA RAISRLRRHG       120
     YVIMHDRAVP YSQATIGHLL IGPGGVMILG SDTNKGIVRY AKGGAMVDGE SLKPAIDKTS       180
     WLGGEVRNQV RAALPTTKIP VYPVLVMVEA SVLWSDGALD GVTIISVKDV VKYVRSKPGR       240
     LNPGQVQQVL AAAQRLFPPY SSNRLAEHVV VDRDQWLTLM DALRTIRERG GDASEMLERL       300
     AQIEADLGRQ ADLIDRAGMP LARAADQPDG PTDSPPPASG TDTATDAIGL LDVDGTGTAK       360
     SLEGPPRARP GEGRRGRILA AVRQPRGSES ISTSSRPPGG DGPTTAKGDQ PPAPGDDRAH       420
     PTSGPGSGS                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page