(data stored in ACNUC7421 zone)

EMBL: CP000820.PE238

CP000820.PE238       Location/Qualifiers
FT   CDS             293188..293994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0240"
FT                   /product="beta-phosphoglucomutase family hydrolase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; beta-phosphoglucomutase family hydrolase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   fal:FRAAL6634 glucose-1-phosphate phosphodismutase;
FT                   beta-phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09707"
FT                   /db_xref="GOA:A8LDU2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDU2"
FT                   /protein_id="ABW09707.1"
FT                   /translation="MLGLPDHIEACLFDLDGVLTRTAAVHAAAWKEMFDDFLENWARRS
FT                   GDPFVPFDIATDYADHVDGRPRIDGVRAFLDSRGIHLPPGAPDDPPSGMTIQALATRKN
FT                   ILLLEKLKEMGVEVFAGSVRYLEELERAGVPRAVVSSSANCAEVVRAAGIEHLLLARVD
FT                   GLVAEERGLAGKPAPDTFLAGAEALGVAPGAAAVFEDAIAGVQAGRAGGFGYVVGVDRV
FT                   GHAEALRGNGADRVVEDLAELLGGGSTGPASAGSASAGPVTGGGDA"
     MLGLPDHIEA CLFDLDGVLT RTAAVHAAAW KEMFDDFLEN WARRSGDPFV PFDIATDYAD        60
     HVDGRPRIDG VRAFLDSRGI HLPPGAPDDP PSGMTIQALA TRKNILLLEK LKEMGVEVFA       120
     GSVRYLEELE RAGVPRAVVS SSANCAEVVR AAGIEHLLLA RVDGLVAEER GLAGKPAPDT       180
     FLAGAEALGV APGAAAVFED AIAGVQAGRA GGFGYVVGVD RVGHAEALRG NGADRVVEDL       240
     AELLGGGSTG PASAGSASAG PVTGGGDA                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page