(data stored in ACNUC7421 zone)

EMBL: CP000820.PE243

CP000820.PE243       Location/Qualifiers
FT   CDS             complement(298650..300521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0245"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG: sco:SCO4377
FT                   putative serine-threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09712"
FT                   /db_xref="GOA:A8LDU7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDU7"
FT                   /protein_id="ABW09712.1"
FT                   /translation="MRSTPPRTAGSDPHPPPSGGHAPQPASFPPETPTRGTSAAGGTFT
FT                   RAWDAVFTPLTAHDPDEISGYPLRARIGEGGMGAVYLSHTPGGRPLAVKVVRPEFAADP
FT                   DFRARFTKEVAIAQRVQGPYTVPVIDADPDAVRPWIATAYVPAPSLAIAVARTGALPAT
FT                   TVLMLIAGVAEALQSIHRVGVIHRDLKPGNVILAADGPRVIDFGVARALDAATAAMTQT
FT                   GARLGTPAFMAPEQVRGAQLDRSGDIFALGATAYYAMTGRPPFGVDAAVFHRIEHQQPD
FT                   WDDCPPQVRDVLARCLEKDPARRPTPTELIELCRLITPIGQLTSDEQLTTGAGWLPPTV
FT                   AAEVTRYHLAPLPTPPPTPAPSPAFAEPPTAAPAGAGGVAAGGAPRRSGHGRRPWLVGA
FT                   IGAVAFVVVCALAAVLLTRSDEPSPSAPMVASAVNGPTADPARPPSDPKAGVPGPVAPG
FT                   PGLPVPGAPPGGLGAGAPGSPPAGAGGPTAPLTPPPAATMPGATAPQAPAPTPKPAPSS
FT                   TAVSGCPGSPDHGYNGDGYGVLTEATSLRSGPYAACGAVASLAQGKKVWLHCSVVNGHN
FT                   NLWWWARLDGSTTAGWIYDGSLKLSYVDDNDDGRTRIYSCDGTYVNR"
     MRSTPPRTAG SDPHPPPSGG HAPQPASFPP ETPTRGTSAA GGTFTRAWDA VFTPLTAHDP        60
     DEISGYPLRA RIGEGGMGAV YLSHTPGGRP LAVKVVRPEF AADPDFRARF TKEVAIAQRV       120
     QGPYTVPVID ADPDAVRPWI ATAYVPAPSL AIAVARTGAL PATTVLMLIA GVAEALQSIH       180
     RVGVIHRDLK PGNVILAADG PRVIDFGVAR ALDAATAAMT QTGARLGTPA FMAPEQVRGA       240
     QLDRSGDIFA LGATAYYAMT GRPPFGVDAA VFHRIEHQQP DWDDCPPQVR DVLARCLEKD       300
     PARRPTPTEL IELCRLITPI GQLTSDEQLT TGAGWLPPTV AAEVTRYHLA PLPTPPPTPA       360
     PSPAFAEPPT AAPAGAGGVA AGGAPRRSGH GRRPWLVGAI GAVAFVVVCA LAAVLLTRSD       420
     EPSPSAPMVA SAVNGPTADP ARPPSDPKAG VPGPVAPGPG LPVPGAPPGG LGAGAPGSPP       480
     AGAGGPTAPL TPPPAATMPG ATAPQAPAPT PKPAPSSTAV SGCPGSPDHG YNGDGYGVLT       540
     EATSLRSGPY AACGAVASLA QGKKVWLHCS VVNGHNNLWW WARLDGSTTA GWIYDGSLKL       600
     SYVDDNDDGR TRIYSCDGTY VNR                                               623
//

If you have problems or comments...

PBIL Back to PBIL home page