(data stored in ACNUC7421 zone)

EMBL: CP000820.PE247

CP000820.PE247       Location/Qualifiers
FT   CDS             complement(303104..304078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0249"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: protein of unknown function UPF0074;
FT                   Helix-turn-helix type 11 domain protein; KEGG: sma:SAV6536
FT                   DeoR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09716"
FT                   /db_xref="GOA:A8LDV1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDV1"
FT                   /protein_id="ABW09716.1"
FT                   /translation="MLETSARLLRLLSLLQTHRDWSGADLADRLGVTARTVRRDVDKLR
FT                   SLGYPVHAAPGTAGGYRLGAGAQLPPLLLDDDEAVAVAVSLRTAAGGSVEGIAESAIRA
FT                   LTKLEQVLPTRLRHRVLALHSVTVSLRGTNPAAVDPDVLMAVATACRENQQLRFDYRDH
FT                   NGIPTARITEPHTLVHTGWRWYLIAWDVGRGAWRNFRLDRIAPKTPTGPRFTPRDPPAD
FT                   DIQAYTSWSVSTAGYRYQARVRYHAPAGVIAASLSPTSAVIEALDDESCLVRTGSNSLD
FT                   ALTIYLSLVDADFDVLEPPELVDRVRELAGRLARAAPPPPPTG"
     MLETSARLLR LLSLLQTHRD WSGADLADRL GVTARTVRRD VDKLRSLGYP VHAAPGTAGG        60
     YRLGAGAQLP PLLLDDDEAV AVAVSLRTAA GGSVEGIAES AIRALTKLEQ VLPTRLRHRV       120
     LALHSVTVSL RGTNPAAVDP DVLMAVATAC RENQQLRFDY RDHNGIPTAR ITEPHTLVHT       180
     GWRWYLIAWD VGRGAWRNFR LDRIAPKTPT GPRFTPRDPP ADDIQAYTSW SVSTAGYRYQ       240
     ARVRYHAPAG VIAASLSPTS AVIEALDDES CLVRTGSNSL DALTIYLSLV DADFDVLEPP       300
     ELVDRVRELA GRLARAAPPP PPTG                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page