(data stored in ACNUC7421 zone)

EMBL: CP000820.PE249

CP000820.PE249       Location/Qualifiers
FT   CDS             305715..306239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09718"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDV3"
FT                   /protein_id="ABW09718.1"
FT                   /translation="MSPRVVMVGSGPSPLEPPPWWHPGHPGAALPKHRVRKAGQIRNTG
FT                   QVRDTSQIRKGRSSAQRRVQALAGPKAADRLDESSHRMAGWWGRLSSGIPASGRNTRHR
FT                   TPRIRGRWCHRRPLTDMKDIDDLRRHQRPRWTEWTARTGSSDRKGTDVPNRRGDIPIRT
FT                   TSRREEDRGIG"
     MSPRVVMVGS GPSPLEPPPW WHPGHPGAAL PKHRVRKAGQ IRNTGQVRDT SQIRKGRSSA        60
     QRRVQALAGP KAADRLDESS HRMAGWWGRL SSGIPASGRN TRHRTPRIRG RWCHRRPLTD       120
     MKDIDDLRRH QRPRWTEWTA RTGSSDRKGT DVPNRRGDIP IRTTSRREED RGIG             174
//

If you have problems or comments...

PBIL Back to PBIL home page