(data stored in ACNUC7421 zone)

EMBL: CP000820.PE25

CP000820.PE25        Location/Qualifiers
FT   CDS             30889..31950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0025"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   fal:FRAAL6830 hypothetical protein; putative ParA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09494"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB33"
FT                   /protein_id="ABW09494.1"
FT                   /translation="MISMALFNNKGGVGKTTLAYHLAHMFQRMGHRVLAVDLDPQANLT
FT                   AQFLDEDELASLWKEDEDLGSSAPRSAVLDPRRSRIRPGNGTLATAIEPIMEGVGDVRL
FT                   SEPVTVEDGLWLLPGDVNLASFEDRLSAAWPNSFLGRDVAALRTTTALHRAIDHGARET
FT                   GADIVIIDVGPNLGAINRAALLSADTILMPLAADLFSLRGLRNIGPTLRDWRVTWQGTI
FT                   LPRIPERIPAPRGLMMPIGYILVEPPARADRPSKGHGRWLDRIPGVFTTSVLGSAAPAD
FT                   GDRSFEIATMKNYAALMPLAQDARKPMFELRAGDGAVGGTQSAVRRCFSDFRELATKVR
FT                   DRLVFIDPTLRRG"
     MISMALFNNK GGVGKTTLAY HLAHMFQRMG HRVLAVDLDP QANLTAQFLD EDELASLWKE        60
     DEDLGSSAPR SAVLDPRRSR IRPGNGTLAT AIEPIMEGVG DVRLSEPVTV EDGLWLLPGD       120
     VNLASFEDRL SAAWPNSFLG RDVAALRTTT ALHRAIDHGA RETGADIVII DVGPNLGAIN       180
     RAALLSADTI LMPLAADLFS LRGLRNIGPT LRDWRVTWQG TILPRIPERI PAPRGLMMPI       240
     GYILVEPPAR ADRPSKGHGR WLDRIPGVFT TSVLGSAAPA DGDRSFEIAT MKNYAALMPL       300
     AQDARKPMFE LRAGDGAVGG TQSAVRRCFS DFRELATKVR DRLVFIDPTL RRG              353
//

If you have problems or comments...

PBIL Back to PBIL home page