(data stored in ACNUC7421 zone)

EMBL: CP000820.PE250

CP000820.PE250       Location/Qualifiers
FT   CDS             306334..307206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09719"
FT                   /db_xref="GOA:A8LDV4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019922"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDV4"
FT                   /protein_id="ABW09719.1"
FT                   /translation="MPAGQWPRGTAERRDTAQELEELGYEMVWLGGATADLELPAALLE
FT                   STENLCVGTGILNIWTEPVDLLADTYGMLEKAHPSRLLLGVGTGHAKRVEATTGRRYHH
FT                   PYGAVLSYLDALDAVGIPVSVRVLAALGPRMLGLAAQRAAGAHPFLVTPEHTRMAREIL
FT                   GDGALLAPEQKIILEVDADRARAIGRAALAVYLDLPNYTNNLRRLGFTDADLAGGGSDR
FT                   LVDALVAWGNMDTIRARLDEHRAAGADHVCAQILTGSRELPREQWRDLAAGLDLRPRAG
FT                   AGAAHGTGP"
     MPAGQWPRGT AERRDTAQEL EELGYEMVWL GGATADLELP AALLESTENL CVGTGILNIW        60
     TEPVDLLADT YGMLEKAHPS RLLLGVGTGH AKRVEATTGR RYHHPYGAVL SYLDALDAVG       120
     IPVSVRVLAA LGPRMLGLAA QRAAGAHPFL VTPEHTRMAR EILGDGALLA PEQKIILEVD       180
     ADRARAIGRA ALAVYLDLPN YTNNLRRLGF TDADLAGGGS DRLVDALVAW GNMDTIRARL       240
     DEHRAAGADH VCAQILTGSR ELPREQWRDL AAGLDLRPRA GAGAAHGTGP                  290
//

If you have problems or comments...

PBIL Back to PBIL home page