(data stored in ACNUC7421 zone)

EMBL: CP000820.PE258

CP000820.PE258       Location/Qualifiers
FT   CDS             complement(316856..317458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09727"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDW2"
FT                   /protein_id="ABW09727.1"
FT                   /translation="MCQDASVAPSEGQPGNGGWVRINDPRLPGWLYVRFEPDDRGRLRP
FT                   RDLFLEGADEPITARHLRSVPLEDAEAWANGMRGQDSVAGRLPIVAPDLRGYAATFATT
FT                   YGKPVSAPTKKAPPRPPIPDAPTVERAPLRRPEGRALPDAFLEEVAGAYSALAQNGQKP
FT                   APVIAAEAEVPVTTVHRWIKEARRRGLLAPARRGATG"
     MCQDASVAPS EGQPGNGGWV RINDPRLPGW LYVRFEPDDR GRLRPRDLFL EGADEPITAR        60
     HLRSVPLEDA EAWANGMRGQ DSVAGRLPIV APDLRGYAAT FATTYGKPVS APTKKAPPRP       120
     PIPDAPTVER APLRRPEGRA LPDAFLEEVA GAYSALAQNG QKPAPVIAAE AEVPVTTVHR       180
     WIKEARRRGL LAPARRGATG                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page