(data stored in ACNUC7421 zone)

EMBL: CP000820.PE259

CP000820.PE259       Location/Qualifiers
FT   CDS             317552..317767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_7031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09728"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDW3"
FT                   /protein_id="ABW09728.1"
FT                   /translation="MVVPRDADAGPTRLLYRPEGAARQLDMSRAKLFRLLASGQIDSVK
FT                   IDGIRRIPHSSLVAYVERISAEQSAA"
     MVVPRDADAG PTRLLYRPEG AARQLDMSRA KLFRLLASGQ IDSVKIDGIR RIPHSSLVAY        60
     VERISAEQSA A                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page