(data stored in ACNUC7421 zone)

EMBL: CP000820.PE26

CP000820.PE26        Location/Qualifiers
FT   CDS             complement(35609..36013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09495"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB34"
FT                   /protein_id="ABW09495.1"
FT                   /translation="MCQITVRSVSDQRRRQPAPQPAARAGSARGHDTASTPRPAPGEDF
FT                   HDGKHRDSAASLGLANVRPRQATTGRKPEGLPPLRPPVLTPMTAQQFTDAVHGLADLIS
FT                   LHLAPSLPRKIRHSPQQNRDRLESIDITEQ"
     MCQITVRSVS DQRRRQPAPQ PAARAGSARG HDTASTPRPA PGEDFHDGKH RDSAASLGLA        60
     NVRPRQATTG RKPEGLPPLR PPVLTPMTAQ QFTDAVHGLA DLISLHLAPS LPRKIRHSPQ       120
     QNRDRLESID ITEQ                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page