(data stored in ACNUC7421 zone)

EMBL: CP000820.PE260

CP000820.PE260       Location/Qualifiers
FT   CDS             318039..318338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09729"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDW4"
FT                   /protein_id="ABW09729.1"
FT                   /translation="MSPPNGERRPGMGSQSGARVSAASDDRSQRNPRAQVEVTDTDVRV
FT                   IAKFSPDLRDGLRTLGAHWVPGHWSVPVEHRAEAVEIVADILGAPVVDDLRGGR"
     MSPPNGERRP GMGSQSGARV SAASDDRSQR NPRAQVEVTD TDVRVIAKFS PDLRDGLRTL        60
     GAHWVPGHWS VPVEHRAEAV EIVADILGAP VVDDLRGGR                               99
//

If you have problems or comments...

PBIL Back to PBIL home page