(data stored in ACNUC7421 zone)

EMBL: CP000820.PE263

CP000820.PE263       Location/Qualifiers
FT   CDS             322084..322320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09732"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDW7"
FT                   /protein_id="ABW09732.1"
FT                   /translation="MIKSSSITVCAECEWRTRFAFHATDEAFQGHTDHTMPMISAHLES
FT                   TGHAVRTTVTTYQSGPDGEDETTVIRIGPKIAA"
     MIKSSSITVC AECEWRTRFA FHATDEAFQG HTDHTMPMIS AHLESTGHAV RTTVTTYQSG        60
     PDGEDETTVI RIGPKIAA                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page