(data stored in ACNUC7421 zone)

EMBL: CP000820.PE267

CP000820.PE267       Location/Qualifiers
FT   CDS             324319..325530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09736"
FT                   /db_xref="GOA:A8LDX1"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX1"
FT                   /protein_id="ABW09736.1"
FT                   /translation="MYPVRPGAGTRAGDPPGPHRGPDRLSGVRARPLQPPGWCVQGRPG
FT                   EPPRPSAYEDHPAAGHPARAPVPRLVVDHHHHERIITMHQAPDLGDEVRYRAQLWTVTK
FT                   VTGSRVELRRGGGYTAYQYATAHHRELRFERAGSSRWKRPAEPEPFDADGFVRAVVAGA
FT                   VERAQDAAEAYHVANPLLTAYHEGAHAIVADAYGMELIGAWADPSSDRARQGQTDYFAW
FT                   GSTDLARVESAVVALAGKVGERMCPAWRDDQDLVSGHHDDLDQARAVLGDDPAVIRAME
FT                   DQARAILTERAGTLEHLAELLVARGADGVKGAELERILSTPRTRLPSQREDRGHAGQPM
FT                   THWSDRARHGHWCGRSVPCPPGCAETLPYTSAPPPAGLRDLMDRARSAERAGGAYRAAP
FT                   GWAA"
     MYPVRPGAGT RAGDPPGPHR GPDRLSGVRA RPLQPPGWCV QGRPGEPPRP SAYEDHPAAG        60
     HPARAPVPRL VVDHHHHERI ITMHQAPDLG DEVRYRAQLW TVTKVTGSRV ELRRGGGYTA       120
     YQYATAHHRE LRFERAGSSR WKRPAEPEPF DADGFVRAVV AGAVERAQDA AEAYHVANPL       180
     LTAYHEGAHA IVADAYGMEL IGAWADPSSD RARQGQTDYF AWGSTDLARV ESAVVALAGK       240
     VGERMCPAWR DDQDLVSGHH DDLDQARAVL GDDPAVIRAM EDQARAILTE RAGTLEHLAE       300
     LLVARGADGV KGAELERILS TPRTRLPSQR EDRGHAGQPM THWSDRARHG HWCGRSVPCP       360
     PGCAETLPYT SAPPPAGLRD LMDRARSAER AGGAYRAAPG WAA                         403
//

If you have problems or comments...

PBIL Back to PBIL home page