(data stored in ACNUC7421 zone)

EMBL: CP000820.PE270

CP000820.PE270       Location/Qualifiers
FT   CDS             complement(326817..327074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09739"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX4"
FT                   /protein_id="ABW09739.1"
FT                   /translation="MATACPDREPLRPAPRIPQAPRRPEVHVLPHSGGTTVQIDHGVTA
FT                   AEIGLALQLQVPALAPWLGTAVDEDGVAEMQFGRPGPIPR"
     MATACPDREP LRPAPRIPQA PRRPEVHVLP HSGGTTVQID HGVTAAEIGL ALQLQVPALA        60
     PWLGTAVDED GVAEMQFGRP GPIPR                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page