(data stored in ACNUC7421 zone)

EMBL: CP000820.PE271

CP000820.PE271       Location/Qualifiers
FT   CDS             327230..327460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL2233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09740"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX5"
FT                   /protein_id="ABW09740.1"
FT                   /translation="MPTVATPADEPARPGDLIDIAGVRALLGVGKARAYQLSRDKSWPD
FT                   PWLDHPQLRLWLRADVEAWLDRHRPGWRDEH"
     MPTVATPADE PARPGDLIDI AGVRALLGVG KARAYQLSRD KSWPDPWLDH PQLRLWLRAD        60
     VEAWLDRHRP GWRDEH                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page