(data stored in ACNUC7421 zone)

EMBL: CP000820.PE272

CP000820.PE272       Location/Qualifiers
FT   CDS             complement(327682..328056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09741"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX6"
FT                   /protein_id="ABW09741.1"
FT                   /translation="MSTWKPSPTQRRMDTAWMLTDISRALLGPTEYEELSDSTVELLSR
FT                   LTSVLMGVADACGDRDDRATWAAAGQPEQAPDRDPDINVTDAELIVDVAERMFTGAFRR
FT                   RNDERRAARDRAAEAEQDAA"
     MSTWKPSPTQ RRMDTAWMLT DISRALLGPT EYEELSDSTV ELLSRLTSVL MGVADACGDR        60
     DDRATWAAAG QPEQAPDRDP DINVTDAELI VDVAERMFTG AFRRRNDERR AARDRAAEAE       120
     QDAA                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page