(data stored in ACNUC7421 zone)

EMBL: CP000820.PE273

CP000820.PE273       Location/Qualifiers
FT   CDS             complement(328053..328334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09742"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX7"
FT                   /protein_id="ABW09742.1"
FT                   /translation="MAHRPHWRCPVSVSDFGIGERFEMAQMLSNLAAMAVTVDDSRAEP
FT                   DMLTDAAAIELLPLVRQLDRAIRAHARSDYEHGVAYALLADLNLGGSL"
     MAHRPHWRCP VSVSDFGIGE RFEMAQMLSN LAAMAVTVDD SRAEPDMLTD AAAIELLPLV        60
     RQLDRAIRAH ARSDYEHGVA YALLADLNLG GSL                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page